
Retatrutide
Triple GLP-1 / GIP / glucagon receptor agonist research peptide. Available in 10mg – 60mg vials.
- Purity
- >99% (HPLC)
- Molecular Weight
- 4731.4 g/mol
- Sequence
- Y-Aib-EGTFTSDYSIQLDKAAQDFVNWLLAQKGKKNDWKHNITQ (C20 diacid + γGlu-2xAEEA linker)
- CAS Number
- 2381089-83-2
- Storage
- Lyophilized −20°C
- Form
- White lyophilized powder
Retatrutide is a triple receptor agonist with activity at GLP-1, GIP, and glucagon receptors. Fatty-acid modified for extended half-life in research models. Supplied as a lyophilised sterile powder in clear vials. Reconstitute with bacteriostatic water for in-vitro research use. Stable for 24+ months lyophilised at -20°C; reconstituted solutions are stable for 7-14 days at 2-8°C. Available in seven dose strengths from 10mg through 60mg per vial — select the appropriate mg for your research protocol from the dropdown. Quality control: RP-HPLC + LC-MS verification per lot. Certificate of Analysis (COA) available on request to verified research customers.
This product is intended solely for in-vitro laboratory research. Not for human or veterinary use, food, cosmetics, or any clinical application.
